DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG31954

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:240 Identity:86/240 - (35%)
Similarity:133/240 - (55%) Gaps:9/240 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVA 79
            |..|...:.|||||..::|...|:.|:|:...: :||||:::.:.::|||||..|..|.|:.|..
  Fly    41 WKLSPRLDGRIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEEWILTAAHCTYGKTADRLKVRL 104

  Fly    80 GVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKV-STIELCNTSFK--AGDLI 141
            |.:....:|....|.|:.....:|...:..|.::|:|..||...:. ..::|..:..|  .|:..
  Fly   105 GTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEAC 169

  Fly   142 KVSGWGQITERNKAVSMQ-VRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSG 204
            .|||||  ..:|...|.: :|.|:|.|:.::.|..:||..|.:|..|.||. :.|.||||:||||
  Fly   170 FVSGWG--NTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSG 232

  Fly   205 GPAVYQ-GQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKALGM 248
            ||.|.: |:|.|:||||.|||:...||||:.|...|.:|.:..|:
  Fly   233 GPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/223 (37%)
Tryp_SPc 25..244 CDD:238113 82/224 (37%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/223 (37%)
Tryp_SPc 51..274 CDD:238113 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.