DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG4271

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:237 Identity:65/237 - (27%)
Similarity:100/237 - (42%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIPLCWAASNEANSR--IVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGA 72
            ||..||.....|.|.  |..||........:|.::.:.|...|||:::..:.|:|||.|||....
  Fly     2 LIGSCWVLILFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPV 66

  Fly    73 SRILVVAG---------VTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTI 128
            .||.|..|         :.|:|...|..           |.:...:|:|:|.|:.|:...:|:.|
  Fly    67 KRITVRVGTPDIYRGGRIIRVTALVVHE-----------NYKNWDNDIALLWLEKPVLSVRVTKI 120

  Fly   129 ELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVP 193
            .|........:....:|||:....:..|:.::::....:.||..|..:  |...:...:.||...
  Fly   121 PLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEE--LVEPVGEELLCAFYT 183

  Fly   194 GVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
             ..|.|.||.|||.|...::.||...|.||.....|.:||||
  Fly   184 -ENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 59/223 (26%)
Tryp_SPc 25..244 CDD:238113 59/220 (27%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 59/220 (27%)
Tryp_SPc 19..231 CDD:214473 59/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.