DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG1304

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:108/250 - (43%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG 69
            :|:|..:|: .:|....|.|:|||........|:.|:||..|:..||||:::..:|:||||||..
  Fly    13 FLLLLAVPV-HSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTN 76

  Fly    70 ---------IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPK 124
                     |.|.|..:.||.......||...|.:|...:.|.  ...:|||:|:|::| |....
  Fly    77 QDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSAS 139

  Fly   125 VSTIELCNTSFKAGDLIKVSGWGQITER---------NKAVSMQVRSVDVALIPRKACMSQYKLR 180
            :..|:|......|...:.:||||:|..:         |...|:.:...|             :|.
  Fly   140 IQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCD-------------ELI 191

  Fly   181 GTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            |....:..|........||.|||||||||..|:.|:..:.......|.|..|..|
  Fly   192 GWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 67/230 (29%)
Tryp_SPc 25..244 CDD:238113 66/229 (29%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/230 (29%)
Tryp_SPc 32..256 CDD:238113 66/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.