DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG4653

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:221 Identity:62/221 - (28%)
Similarity:108/221 - (48%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGA-------SRILVVAGVTRLTE 86
            :|.::.|.|:.::||..|..:|||:|:..:.::||||||...|.       |..:.|..:.||| 
  Fly    29 LPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLT- 92

  Fly    87 TGVRSGVDKVYTPKAYNTRTL--TSDVAVLKLK-APISGPKVSTIELCNTSFKAGDLIKVSGWGQ 148
            .|....:.|:.....|::...  ::|:|:|:|: :.:.....:.|:|......||..|..||||.
  Fly    93 GGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGS 157

  Fly   149 ITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVKD---ACEGDSGGPAVYQ 210
             ::.:.::|..::......:....|.::..|:   ...:.|.| |..:|   .|.||:|.||.|.
  Fly   158 -SQVDGSLSHVLQVATRQSLSASDCQTELYLQ---QEDLLCLS-PVDEDFAGLCSGDAGAPASYN 217

  Fly   211 GQLCGIVSWGV-GCARKSSPGVYTNV 235
            .||.||.::.| ||..:...| |.:|
  Fly   218 NQLVGIAAFFVSGCGSEQPDG-YVDV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 62/221 (28%)
Tryp_SPc 25..244 CDD:238113 62/221 (28%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 62/220 (28%)
Tryp_SPc 30..249 CDD:214473 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.