DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG9676

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:256 Identity:90/256 - (35%)
Similarity:134/256 - (52%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLWLVLHLIPLCWA---ASNEA--NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHV 60
            |...|  ..|:.||.|   |.|::  ..|||||........|:.::||..|:..||||:::..:|
  Fly     1 MLPFW--TSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63

  Fly    61 VTAAHCVKG----IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS 121
            ||||||||.    ..|:.:.:.||...|:..|||..|..|.....||:.  ..|||||:|:..::
  Fly    64 VTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLT 126

  Fly   122 -GPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITN 185
             ...::.|:|..........:.:||||.|::|. .:|..:..|.|..:.|::|...| || .:..
  Fly   127 FNSNIAAIKLATEDPPNDATVDISGWGAISQRG-PISNSLLYVQVKALSRESCQKTY-LR-QLPE 188

  Fly   186 TMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI-DKA 245
            |..|...|..|.||.|||||||.|||:|.|:.|:.:|...:::|..|..|..:|::| :||
  Fly   189 TTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/222 (36%)
Tryp_SPc 25..244 CDD:238113 79/224 (35%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/222 (36%)
Tryp_SPc 28..248 CDD:238113 79/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.