DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and gd

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:220 Identity:52/220 - (23%)
Similarity:92/220 - (41%) Gaps:54/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVPYLVNLRIGG----NFMCGGSLVTPQHVVTAAHCVKGIG----ASRILVVAGVTRL----TET 87
            |.|:|..:.:..    :|.||||||:.:.|:::|||.|...    ::.:||..|...|    .|.
  Fly   261 SWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEG 325

  Fly    88 GVRSGVDKVYTPKAYNTR--TLTSDVAVLKLKAPI------------SGPKVSTIELCNTSFKAG 138
            .:.:.||.:|....:|::  :..:|:||:.||..:            ||..       .|.:..|
  Fly   326 SLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSS-------KTEYIVG 383

  Fly   139 DLIKVSGWG---QITERNKAVSMQV---RSVDVA--------LIPRKACM-SQYKLRGTITNTMF 188
            :...|.||.   ....|::.:|.::   :|.|.:        ::....|. :....|...:|..|
  Fly   384 ERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTF 448

  Fly   189 CASVPGVKDACEGDS--GGPAVYQG 211
            ||.:    .|.|.|:  .|.::|.|
  Fly   449 CAGI----QAEERDTHQSGASIYTG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 52/220 (24%)
Tryp_SPc 25..244 CDD:238113 52/220 (24%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 52/220 (24%)
Tryp_SPc 258..526 CDD:214473 52/220 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.