DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG31681

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:253 Identity:84/253 - (33%)
Similarity:128/253 - (50%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVV 78
            |.|.......|||||..:.|..||:.|:::......|||.:.:.:.::|||||:..:..:.:.|.
  Fly    18 CAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVR 82

  Fly    79 AGVTRLTETG-----VRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKA 137
            ||.:..::.|     :::.....|.||.||    ..|:|||.|:||:. |..|..|.|...:..|
  Fly    83 AGSSYWSKGGQVLKVLKTIAHPKYVPKLYN----PYDIAVLILEAPLRLGGTVKKIPLAEQTPVA 143

  Fly   138 GDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVK-DACEG 201
            |.::..||||...|.:..:...::.|.||::.|..|:..|| ...||..|.||.  |.: |.|:|
  Fly   144 GTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNITIDMICAD--GQRWDTCQG 205

  Fly   202 DSGGPAVY-----QGQLCGIVSWGVGCARKSSPGVYTNVK--------TVRSFIDKAL 246
            |||||.:.     ..||.|:||||.||.  ::||||.::.        ||:..|.|::
  Fly   206 DSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKNIYKSI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 80/237 (34%)
Tryp_SPc 25..244 CDD:238113 80/238 (34%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/229 (34%)
Tryp_SPc 29..250 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.