DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG31269

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:231 Identity:67/231 - (29%)
Similarity:114/231 - (49%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLR-IGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLT 85
            :.||:||...:....||.::|: |.|...|||:::....|:||||||:......::||.|..:..
  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99

  Fly    86 ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSGWGQ- 148
            :.|.|..:..::....|:...:.:|:|:|:|..||: ..:...|.|.....:.||.:.::|||. 
  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST 164

  Fly   149 ITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGV-------KDACEGDSGGP 206
            :......:.:||  :.:..:|.:.|      :..::|...| .|..:       :.||.||||||
  Fly   165 VLWGTSPIDLQV--LYLQYVPHREC------KALLSNDEDC-DVGHICTFSRLGEGACHGDSGGP 220

  Fly   207 AVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242
            .|..|.|.|:|:||..|| ...|.|:.:|...|.:|
  Fly   221 LVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 66/227 (29%)
Tryp_SPc 25..244 CDD:238113 66/228 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/227 (29%)
Tryp_SPc 38..258 CDD:238113 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.