DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG32376

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:227 Identity:83/227 - (36%)
Similarity:115/227 - (50%) Gaps:5/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTET 87
            :|||.|..:.....|:..:|...|.|:||..::....::||.||..| ...:..|..|..:....
  Fly    64 TRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRRG 127

  Fly    88 GVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPI-SGPKVSTIELCNT-SFKAGDLIKVSGWGQIT 150
            |....|.|:....|||..|:..|:|::|||:|: .|..|..::|.:| :.|......|||||..:
  Fly   128 GQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITS 192

  Fly   151 ERNKAVSMQVRSVDVALIPRKACMSQYKLRG-TITNTMFCASVPGVKDACEGDSGGPAVYQGQLC 214
            ...:.|...:|.|.:..|.|..|...||..| .|...|.|||... ||:|.||||||...:|.|.
  Fly   193 ANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTN-KDSCSGDSGGPLTSRGVLY 256

  Fly   215 GIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            ||||||:|||.|:.||||.|.|....:|.|.:
  Fly   257 GIVSWGIGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/220 (37%)
Tryp_SPc 25..244 CDD:238113 81/221 (37%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 81/220 (37%)
Tryp_SPc 66..287 CDD:238113 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.