DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prtn3

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:243 Identity:70/243 - (28%)
Similarity:108/243 - (44%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRIVGGVPVDIASVPYLVNLRIG---GNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRL 84
            |:||||......|.||:.:|::.   |:..|||:|:.|:.|:|||||::.|....:.||.|...|
  Rat   196 SKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDL 260

  Fly    85 TET---GVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIEL--CNTSFKAGDLIKV 143
            ..:   ..:..:.:|: ...||.....:||.:|:|..|.| |.:|:...|  .:.|...|.....
  Rat   261 LSSEPEQQKFTITQVF-ENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLA 324

  Fly   144 SGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTM-----FCASVP----GVKDAC 199
            .|||::..|             |..||..    ::|..|:...:     .|..||    |:   |
  Rat   325 MGWGRLGTR-------------APTPRVL----HELNVTVVTFLCREHNVCTLVPRRAAGI---C 369

  Fly   200 EGDSGGPAVYQGQLCGIVSWGV-GCARKSSPGVYTNVKTVRSFIDKAL 246
            .||||||.:..|.|.|:.|:.: .||....|..:..|....::|...|
  Rat   370 FGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 67/236 (28%)
Tryp_SPc 25..244 CDD:238113 68/237 (29%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.