DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and LOC312273

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:239 Identity:87/239 - (36%)
Similarity:129/239 - (53%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-----GIGASRILV 77
            :.:.:.|||||......||||.|:|. .|:.:|||||:|.|.|::||||..     .:|...|..
  Rat    18 TEDNDDRIVGGYTCQEHSVPYQVSLN-AGSHICGGSLITDQWVLSAAHCYHPQLQVRLGEHNIYE 81

  Fly    78 VAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIEL---CNTSFKAG 138
            :.|..:..:..      |:.....|:..|:.:|:.::|||:|.: ..|||||.|   |.|   ||
  Rat    82 IEGAEQFIDAA------KMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCPT---AG 137

  Fly   139 DLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGD 202
            ....|||||.:....::.|: ::.:|..::....|...|..:  |||.|||.. :.|.||:|:.|
  Rat   138 TECLVSGWGVLKFGFESPSV-LQCLDAPVLSDSVCHKAYPRQ--ITNNMFCLGFLEGGKDSCQYD 199

  Fly   203 SGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            ||||.|..|::.||||||.|||.:..|||||.|....::|.:.:
  Rat   200 SGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 86/227 (38%)
Tryp_SPc 25..244 CDD:238113 86/228 (38%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 86/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.