DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG3795

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:237 Identity:71/237 - (29%)
Similarity:115/237 - (48%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVGGVPVDIAS-VPYLVNLRI-------GGNFMCGGSLVTPQHVVTAAHCV----KGIGASRILV 77
            :.||...|... |.|.|:||:       |.|..|.|::.:.:.::|||||:    :.:.|.:::|
  Fly    46 VTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMV 110

  Fly    78 VAGVTR----LTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKA 137
            |||..|    .:.|.:....:.:..||....::...|:.::.|:|.:| |..|:.|.|.|....|
  Fly   111 VAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVA 175

  Fly   138 GDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS--VPGVKDACE 200
            |....:.|||.:.:........:.. |:.::|...|   .||.|.....|.||:  .....|:|:
  Fly   176 GAPCSIVGWGTVIQFGPLPDEAING-DMQILPDTFC---EKLLGWSNAGMLCANDKHDSDVDSCQ 236

  Fly   201 GDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242
            ||||||.:....:.||||:|:||....|.|:||:|...|.:|
  Fly   237 GDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 70/235 (30%)
Tryp_SPc 25..244 CDD:238113 71/237 (30%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/223 (30%)
Tryp_SPc 60..278 CDD:214473 66/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.