DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG3795

DIOPT Version :10

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_569939.2 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:102 Identity:24/102 - (23%)
Similarity:36/102 - (35%) Gaps:38/102 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RNLSVPPGTQSLTNK------ARPAKVKEEGD--------TP-------------AADANDAVTI 91
            ||:..|...|...|:      |.|.|::.|.:        ||             :...|:...|
  Fly   833 RNVQNPQYIQCKKNQNPRRIPALPMKIQSESNLVTSGMVFTPRDEQLNGIGNSLSSLSLNEPPDI 897

  Fly    92 PRPIPTIPPPPGRRTLPSELIPDEN-------TKNAP 121
            |.|:|.:...|    :|:.||...|       |:.||
  Fly   898 PAPLPPVVTYP----IPASLISPSNRVSMSPPTRMAP 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 24/102 (24%)
CG3795NP_569939.2 Tryp_SPc 60..281 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.