DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG14780

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:138/269 - (51%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLHLIPLCWAASNEAN--SRIVGGVPVDIASVPYLVNLRI-------GGNFMCGGSLVTPQHV 60
            |.:|    .|.||..:.|  |||:.|.........:||::|:       |...:|||:|:.|:.|
  Fly    15 WFLL----ACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75

  Fly    61 VTAAHCV------KGIGASRILVVAGVTRLTE--TG-VRSGVDKVYTPKAYNTRTLTSDVAVLKL 116
            :|||||:      :...||..:||.|.....|  .| :.|.|..:.....::..::..||.:|.|
  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140

  Fly   117 KA--PISGP------KVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKAC 173
            :.  |:| |      .|:.|:|.......|.|.:|:|||: ||:: ::|..:.:.:|:.|..:.|
  Fly   141 RTGLPMS-PGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR-TEQS-SLSNILLTANVSTIRHQTC 202

  Fly   174 MSQYKLRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTV 238
            ...|: .|.:...|....:.|..|:|:||||||.|::|:|.|:||||.|||....||||.:|:..
  Fly   203 RMIYR-SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYY 266

  Fly   239 RSFIDKALG 247
            |.:|:...|
  Fly   267 RQWIEGRSG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 78/241 (32%)
Tryp_SPc 25..244 CDD:238113 78/242 (32%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 78/241 (32%)
Tryp_SPc 33..271 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.