DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss30

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:271 Identity:88/271 - (32%)
Similarity:127/271 - (46%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRI-GGNFMCGGSLVTPQHVVTAAHCV- 67
            |....::|.....|.:| .:||||........|:.|:|.| ....:|||||:....|:|||||. 
Mouse    55 WARGDILPSVCGHSRDA-GKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFR 118

  Fly    68 KGIGASRILV-VAGVT------RLTETGVRSGVDKVYTPKAYNTRTLTS-DVAVLKLKAPISGPK 124
            :.:..|...| |.|:|      ..|...||:    ::....|.....:| |:|:::|..|:...:
Mouse   119 RSLNPSFYHVKVGGLTLSLLEPHSTLVAVRN----IFVHPTYLWADASSGDIALVQLDTPLRPSQ 179

  Fly   125 VSTIEL--CNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGT----- 182
            .:.:.|  ..|....|.:..|:|||...||:.|..:|  .:.|.|:..:.|...|..:|:     
Mouse   180 FTPVCLPAAQTPLTPGTVCWVTGWGATQERDMASVLQ--ELAVPLLDSEDCEKMYHTQGSSLSGE 242

  Fly   183 --ITNTMFCAS-VPGVKDACEGDSGGPAVYQGQLC---------GIVSWGVGCARKSSPGVYTNV 235
              |.:.|.||. |.|.||:|:||||||.|     |         ||.|||:||||...|||||.|
Mouse   243 RIIQSDMLCAGYVEGQKDSCQGDSGGPLV-----CSINSSWTQVGITSWGIGCARPYRPGVYTRV 302

  Fly   236 KTVRSFIDKAL 246
            .|...:|.:.|
Mouse   303 PTYVDWIQRIL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/246 (33%)
Tryp_SPc 25..244 CDD:238113 83/247 (34%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.