DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Elane

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:271 Identity:67/271 - (24%)
Similarity:113/271 - (41%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGI 70
            ::|.|:.:|.|.::|    ||||.|....:.|::|:|:..|...||.:|:....|::|||||.|.
  Rat    18 MLLALLLVCPALASE----IVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGR 78

  Fly    71 GASRILVVAG---VTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKL-------------KAP 119
            ....:.||.|   :.|...|.....|.::: ...::...|.:|:.:::|             :.|
  Rat    79 NFQSVQVVLGAHDLRRREPTRQIFSVQRIF-ENGFDPSRLLNDIVIIQLNGSATINANVQVAELP 142

  Fly   120 ISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTIT 184
            ..|..|.....|          ...|||:: ..|:.:...::.::|.:: ...|..:..:     
  Rat   143 AQGQGVGNRTPC----------VAMGWGRL-GTNRPLPSVLQELNVTVV-TNLCRRRVNV----- 190

  Fly   185 NTMFCASVP----GVKDACEGDSGGPAVYQGQLCGIVSW--GVGCARKSSPGVYTNV-------- 235
                |..||    |:   |.||||||.|....:.||.|:  | ||.....|..:..|        
  Rat   191 ----CTLVPRRQAGI---CFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWIN 247

  Fly   236 KTVRSFIDKAL 246
            ..:||..|:.|
  Rat   248 SIIRSHDDRPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 60/247 (24%)
Tryp_SPc 25..244 CDD:238113 60/248 (24%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 59/243 (24%)
Tryp_SPc 33..249 CDD:238113 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.