DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Klk9

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:249 Identity:71/249 - (28%)
Similarity:111/249 - (44%) Gaps:31/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68
            |.|.|.|..|. |....|::|.||.......|.|:...|......:||.:|:..|.::|||||.|
  Rat     3 LGLTLVLFSLL-AGHCGADTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHCRK 66

  Fly    69 GI--------------GASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP 119
            ..              |..::|:|      |:.....|.:...:...:|     .|:.:::|...
  Rat    67 PYLWVRLGEHHLWQWEGPEKLLLV------TDFFPHPGFNPDLSANDHN-----DDIMLIRLPRK 120

  Fly   120 IS-GPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTI 183
            :. .|.|..:.|..:....|....:||||.::.......|.::..:::::..|.|...|.  |.|
  Rat   121 VRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAYP--GHI 183

  Fly   184 TNTMFCASV-PGVKDACEGDSGGPAVYQGQLCGIVSWG-VGCARKSSPGVYTNV 235
            :..|.||.: .|.:.:|:||||||.|.:|.|.||||.| ..|:|...|.|||:|
  Rat   184 SEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 64/229 (28%)
Tryp_SPc 25..244 CDD:238113 63/228 (28%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 63/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.