DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Klk11

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:242 Identity:77/242 - (31%)
Similarity:117/242 - (48%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASN-EANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG 69
            ::|..|.|.....: ...:||:.|......|.|:.|.|......:||.:|:.|:.::|||||.| 
  Rat    31 MILRFIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRK- 94

  Fly    70 IGASRILVVAGVTRLTETG---VRSGVDKVYTPKAYN----TRTLTSDVAVLKLKAPISGPK-VS 126
               ...:::.|...|.:|.   .|....:.:....:|    .:...:|:.::|:.:|....: |.
  Rat    95 ---PHYVILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVR 156

  Fly   127 TIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS 191
            .:.|.:....||....:||||..:.....:...:|..:|::|..|.|...|.  |.||:||.|||
  Rat   157 PLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYP--GNITDTMLCAS 219

  Fly   192 V--PGVKDACEGDSGGPAVYQGQLCGIVSWGVG-CARKSSPGVYTNV 235
            |  .| ||:|:||||||.|..|.|.||:|||.. ||....|||||.|
  Rat   220 VRKEG-KDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 74/223 (33%)
Tryp_SPc 25..244 CDD:238113 73/222 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 74/223 (33%)
Tryp_SPc 51..275 CDD:238113 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.