DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss34

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:283 Identity:90/283 - (31%)
Similarity:129/283 - (45%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLWLVLHLIPLCWAA-------SNEANSRIVGGVPVDIASVPYLVNLRIGG------NFMCGG 52
            :..||.:...:| |..:       |.:....||||.||..:..|:.|:||...      ..:|||
  Rat     3 LGMLWFLFLTLP-CLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGG 66

  Fly    53 SLVTPQHVVTAAHCV--KGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLT---SDVA 112
            ||:.||.|:||||||  |.:.||...|..|..||.|......|.|:.....::.:...   :|:|
  Rat    67 SLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIA 131

  Fly   113 VLKLKA---------PISGPKVS-TIELCNTSFKAGDLIKVSGWGQIT-ERNKAVSMQVRSVDVA 166
            :|||.:         |:|.|..| .|....|.:       |:|||.|. .|.......:|.|.|.
  Rat   132 LLKLDSTVVLSERVHPVSLPAASQRISSKKTWW-------VAGWGVIEGHRPLPPPCHLREVAVP 189

  Fly   167 LIPRKACMSQYKLRGTITNT-------MFCASVPGVKDACEGDSGGPAVYQGQLC-----GIVSW 219
            ::....|..:|:...::..|       |.||.:.| :|:|:.|||||.|.:.. |     |:|||
  Rat   190 IVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEG-RDSCQADSGGPLVCRWN-CSWVQVGVVSW 252

  Fly   220 GVGCARKSSPGVYTNVKTVRSFI 242
            |:||.....|||||.|.:..|:|
  Rat   253 GIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 84/251 (33%)
Tryp_SPc 25..244 CDD:238113 85/252 (34%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 85/252 (34%)
Tryp_SPc 33..275 CDD:214473 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.