DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and LOC286960

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:232 Identity:81/232 - (34%)
Similarity:121/232 - (52%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-----GIGASRILVVAGV 81
            :.:||||.......|||.|:|..|.:..|||||::.|.|::||||.|     .:|...|.|:.|.
  Rat    21 DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGG 85

  Fly    82 TRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPKVSTIELCNTSFKAGDLIKVSG 145
            .:..:      .:|:.....||..||.:|:.::|||:| :...:|||:.|..:.........|||
  Rat    86 EQFID------AEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSG 144

  Fly   146 WGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVY 209
            ||............::.::..::...:|...|.  |.||:.|||.. :.|.||:|:||||||.|.
  Rat   145 WGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKDSCDGDSGGPVVC 207

  Fly   210 QGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            .|::.||||||..||.:..|||||.|....|:|.:.:
  Rat   208 NGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 80/224 (36%)
Tryp_SPc 25..244 CDD:238113 81/225 (36%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 80/224 (36%)
Tryp_SPc 24..243 CDD:238113 81/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.