DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss3b

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:243 Identity:89/243 - (36%)
Similarity:130/243 - (53%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG-----I 70
            :||     ::.:.:||||......|:||.|:|..|.:| |||||:..|.||:||||.|.     :
  Rat    16 LPL-----DDDDDKIVGGYTCQKNSLPYQVSLNAGYHF-CGGSLINSQWVVSAAHCYKSRIQVRL 74

  Fly    71 GASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTS 134
            |...|.||.|..:..:..      |:....:||..|..:|:.::||.:|.: ..:|||:.|..:.
  Rat    75 GEHNIDVVEGGEQFIDAA------KIIRHPSYNANTFDNDIMLIKLNSPATLNSRVSTVSLPRSC 133

  Fly   135 FKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDA 198
            ..:|....|||||............::.:|..::...:|.|.|.  |.||:.|||.. :.|.||:
  Rat   134 GSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYP--GKITSNMFCLGFLEGGKDS 196

  Fly   199 CEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            |:||||||.|..|||.|:||||.|||:|..|||||.|....::|.:.:
  Rat   197 CQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 86/224 (38%)
Tryp_SPc 25..244 CDD:238113 87/225 (39%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 86/224 (38%)
Tryp_SPc 25..243 CDD:238113 87/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.