DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Klkb1

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:253 Identity:84/253 - (33%)
Similarity:133/253 - (52%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SNEANSRIVGGVPVDIASVPYLVNLR---IGGNFMCGGSLVTPQHVVTAAHCVKGIGASRI-LVV 78
            :.:.|:|||||....:...|:.|:|:   :..|.|||||::..|.::|||||..||....: .:.
  Rat   384 TTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIY 448

  Fly    79 AGVTRLTETGVR---SGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTSFKAGDL 140
            .|:..|:|...:   |.:.::...:.|.....:.|:|::||:.|::..:... .:|..|....:.
  Rat   449 GGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQK-PICLPSKADTNT 512

  Fly   141 IK----VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASV-PGVKDACE 200
            |.    |:|||...||.:..:: ::...:.|:|.:.|..:|: ...||..|.||.. .|..|||:
  Rat   513 IYTNCWVTGWGYTKERGETQNI-LQKATIPLVPNEECQKKYR-DYVITKQMICAGYKEGGIDACK 575

  Fly   201 GDSGGPAV--YQG--QLCGIVSWGVGCARKSSPGVYTNV--------KTVRSFIDKAL 246
            ||||||.|  :.|  ||.||.|||.|||||..|||||.|        :.::|..::||
  Rat   576 GDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERAL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/241 (34%)
Tryp_SPc 25..244 CDD:238113 80/242 (33%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 80/233 (34%)
Tryp_SPc 391..621 CDD:238113 79/232 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.