DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss38

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:123/278 - (44%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIPL-----CWAAS-------NEANS--------------RIVGGVPVDIASVPYLVNLRIGGNF 48
            |.||     .|..|       ::|||              :::||........|:.|:|...|..
Mouse    15 LFPLLLASPTWVTSVSRRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLHYSGFH 79

  Fly    49 MCGGSLVTPQHVVTAAHCV-KGIGASRILVVAGVTRLTETGVRSGVDKVYT----PKAYNTRTLT 108
            :||||:::...|::||||. :|.......:..|:|.|.:....:...::|.    |.......:.
Mouse    80 ICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIG 144

  Fly   109 SDVAVLKLKA---------PISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVD 164
            .|||:::||:         ||..|. |.:.|.|.|      ...:|||.|:.:.: ...::....
Mouse   145 GDVALVQLKSAIVFSDFVLPICLPP-SDLYLINLS------CWTTGWGMISPQGE-TGNELLEAQ 201

  Fly   165 VALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAV-YQGQL---CGIVSWGVGCA 224
            :.||||..|...|.|...:...|.||: :..:|:.||||||.|.| .|.|.   .||||||.|||
Mouse   202 LPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCA 266

  Fly   225 RKSSPGVYTNVKTVRSFI 242
            :...|||:.||....|:|
Mouse   267 QPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 73/236 (31%)
Tryp_SPc 25..244 CDD:238113 74/237 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 74/235 (31%)
Tryp_SPc 58..284 CDD:214473 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.