DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS55

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:251 Identity:72/251 - (28%)
Similarity:116/251 - (46%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV--KGIGASRILVVAGVTRLT 85
            |||.||:..::...|:.|:::......||||::....::|||||:  :.:....:.||.|...||
Human    66 SRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLT 130

  Fly    86 ETGVR-SGVDKVYTPKAYNTRTLTSDVAVLKLKAPI------------SGPKVSTIELCNTSFKA 137
            ...:. ..|..:...|.:....:.:|:|:|.|.:||            :.|..:|...|      
Human   131 SPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWREC------ 189

  Fly   138 GDLIKVSGWGQITERNK-AVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVK----D 197
                .|:||||....:| :|...:....:.::..:.|.   |:...:|..|.||   |.|    |
Human   190 ----WVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECS---KMFPKLTKNMLCA---GYKNESYD 244

  Fly   198 ACEGDSGGPAV---------YQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244
            ||:||||||.|         ||   .||:|||..|..|::||:||::.....:|:|
Human   245 ACKGDSGGPLVCTPEPGEKWYQ---VGIISWGKSCGEKNTPGIYTSLVNYNLWIEK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 69/246 (28%)
Tryp_SPc 25..244 CDD:238113 69/247 (28%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 69/246 (28%)
Tryp_SPc 68..298 CDD:238113 70/249 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.