DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and try-5

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:291 Identity:73/291 - (25%)
Similarity:116/291 - (39%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AASNEANSRIVGGVPVDIASVPYLVNLRI---GGNF--MCGGSLVTPQHVVTAAHCV-KGIGA-- 72
            ||.|..|       |..:|  |:.|.:|:   .|:|  :|||:|:|.:||:|||||. |..||  
 Worm    43 AAGNTGN-------PTHLA--PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKK 98

  Fly    73 -------------------------SRILVVAGV--TRL---------TETGVRSGVDKVYTPKA 101
                                     :|.:|..|.  |||         .:.|....:.:......
 Worm    99 EGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDF 163

  Fly   102 YNTR-TLTSDVAVLKLKAPI---SGPKVSTIE-LCNTSFKAGDLIKVSGWGQITER---NKAVSM 158
            |.|. ...:|:.:|:|::.|   .|...:.:. |...:.::|..:...|||....:   |.|..|
 Worm   164 YKTHCEQGNDIVILELESTIDDVEGANYACLPFLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPM 228

  Fly   159 QVRSVDVALIPRKACMSQYKLRGT-ITNTMFCASVPGVKDACEGDSGGPAVYQGQ------LCGI 216
             ::.:.:|......|...:   || |....||.:....|:.|.|||||...:...      :..|
 Worm   229 -IQVLTLATETLATCEENW---GTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAI 289

  Fly   217 VSWGVGCAR---KSSP--GVYTNVKTVRSFI 242
            ||:|..|.:   .|.|  .:.|:|:..:.||
 Worm   290 VSYGSDCVQLIGGSEPRSQINTDVRKHQKFI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 67/281 (24%)
Tryp_SPc 25..244 CDD:238113 69/282 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.