DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and try-1

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:242 Identity:80/242 - (33%)
Similarity:114/242 - (47%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNL--RIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTE 86
            |::||......|.|:.|.|  |: |:..|||||:.|..|:|||||           .|...|.|.
 Worm    57 RLIGGSESSPHSWPWTVQLLSRL-GHHRCGGSLIDPNFVLTAAHC-----------FAKDRRPTS 109

  Fly    87 TGVRSG-----------VDKVYTPKAYNTRTLTS-DVAVLKLKAPISGPKVSTIELCNTSFKAGD 139
            ..||.|           |..|.....||....:| |.|::::..|:: ...:...:|..|..|.:
 Worm   110 YSVRVGGHRSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVN-TSTTARPICLPSLPAVE 173

  Fly   140 --LIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTI-TNTMFCASVP-GVKDACE 200
              |..|:|||...|.:...:..:|.:.|.|:....|.|.....|.| ..:|.||... |..|:|:
 Worm   174 NRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQ 238

  Fly   201 GDSGGPAVY----QGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFID 243
            ||||||.:.    ..:|.|:||||:||||...||||.||.:..::|:
 Worm   239 GDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/239 (33%)
Tryp_SPc 25..244 CDD:238113 79/241 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.