DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Try5

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:237 Identity:94/237 - (39%)
Similarity:131/237 - (55%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-- 68
            |.|.|:....|...:.:.:||||......|:||.|:|..|.:| |||||:..|.||:||||.|  
Mouse     5 LFLALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSLNSGYHF-CGGSLINDQWVVSAAHCYKTR 68

  Fly    69 ---GIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIE 129
               .:|...|.|:.|    .|..|.|.  |:.....:|:|||.:|:.::||.:|:: ..:|:|:.
Mouse    69 IQVRLGEHNINVLEG----NEQFVNSA--KIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVA 127

  Fly   130 LCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VP 193
            |.::...||....:||||............::.:|..|:|:..|.:.|.  |.|||.|.|.. :.
Mouse   128 LPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYP--GKITNNMICVGFLE 190

  Fly   194 GVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            |.||:|:||||||.|..|||.||||||.|||.|.:|||||.|
Mouse   191 GGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 90/219 (41%)
Tryp_SPc 25..244 CDD:238113 90/218 (41%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 90/219 (41%)
Tryp_SPc 24..242 CDD:238113 90/218 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.