DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Try5

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:227 Identity:88/227 - (38%)
Similarity:123/227 - (54%) Gaps:28/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG-----IGASRILVVAGV 81
            :.:||||......||||.|:|..|.:| |||||:..|.||:||||.|.     :|...|.|:.|.
  Rat    21 DDKIVGGYTCQENSVPYQVSLNSGYHF-CGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGN 84

  Fly    82 TRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSG 145
            .:.....      |:.....:|.|.|.:|:.::||..|:: ..:|:|:.|.::...||....:||
  Rat    85 EQFVNAA------KIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVATVALPSSCAPAGTQCLISG 143

  Fly   146 WGQITERNKAVSMQVRS------VDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDS 203
            ||      ..:|:.|.:      :|..::|:..|.:.|.  |.|||.|.|.. :.|.||:|:|||
  Rat   144 WG------NTLSLGVNNPDLLQCLDAPVLPQADCEASYP--GKITNNMICVGFLEGGKDSCQGDS 200

  Fly   204 GGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            |||.|..|||.||||||.|||.|.:|||||.|
  Rat   201 GGPVVCNGQLQGIVSWGYGCALKDNPGVYTKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 88/225 (39%)
Tryp_SPc 25..244 CDD:238113 88/224 (39%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 88/225 (39%)
Tryp_SPc 24..242 CDD:238113 88/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.