DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and LOC101730988

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_012810074.1 Gene:LOC101730988 / 101730988 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:247 Identity:94/247 - (38%)
Similarity:135/247 - (54%) Gaps:16/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG-- 69
            :|.:..|..||:...:.:|:||......||||:|:|..|.:| |||||:..|.||:||||.:.  
 Frog     3 LLLICVLLGAAAAFDDDKIIGGATCAKNSVPYIVSLNAGYHF-CGGSLLNNQWVVSAAHCYQASI 66

  Fly    70 ---IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIEL 130
               :|...|.:..|    ||..:.|.  ||....:||:||..:|:.::||.:|.| ...|..:.|
 Frog    67 QVRLGEHNIALSEG----TEQFINSA--KVIRHPSYNSRTTDNDIMLIKLASPASLNSYVKAVSL 125

  Fly   131 CNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPG 194
            .::...||....|||||..:.........::.::..::....|.|.|.  |.|||.||||. :.|
 Frog   126 PSSCAAAGTSCLVSGWGNTSASGSNYPNLLQCLNAPILTTAQCSSAYP--GQITNNMFCAGFLEG 188

  Fly   195 VKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            .||:|:||||||.|..|||.||||||:|||:::.||||..|....|:|...:
 Frog   189 GKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRNYPGVYAKVCNYNSWIQSTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 89/224 (40%)
Tryp_SPc 25..244 CDD:238113 90/225 (40%)
LOC101730988XP_012810074.1 Tryp_SPc 21..239 CDD:238113 90/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.