DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and f12

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:237 Identity:86/237 - (36%)
Similarity:124/237 - (52%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-KGIGASRILVVAGVTRLTET 87
            |||||:....||.||:..|.|..:| |||||::|..:||||||: :....::|.||.|.:|...|
 Frog   358 RIVGGLVALPASHPYIAALYIDNHF-CGGSLISPCWIVTAAHCLDQRPNVTKISVVLGQSRFNTT 421

  Fly    88 G---VRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIE-----LC-NTSFKAGDLIK- 142
            .   |...|:|....:.|...||..|:|::|:|: |:|...|...     :| ...||..:..| 
 Frog   422 DQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKS-INGLCASEFSQFVQPICLPQQFKMAESTKQ 485

  Fly   143 --VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSG 204
              |:|||...|..:..:..::...:.:||...|.|.......:...|.||. :.|..|||:||||
 Frog   486 CVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGMLCAGFMEGGVDACQGDSG 550

  Fly   205 GPAVYQG----QLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242
            ||.|.:.    :|.|:||||.|||.::.|||||.|.:...:|
 Frog   551 GPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWI 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 85/235 (36%)
Tryp_SPc 25..244 CDD:238113 85/236 (36%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 85/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.