DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and LOC100485189

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:220 Identity:70/220 - (31%)
Similarity:105/220 - (47%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG-----IGASRILVVAGVTR 83
            ||:||......|.|:..:|......:|||.|:....|:|||||...     :|...:.|..|..:
 Frog    21 RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHCQLSSLQVRLGEHNLAVYEGKEQ 85

  Fly    84 LTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSGWG 147
            .      |..:|:.....:|..|..:|:.:|||.:|:: ...|.||.|...:...|:...|||||
 Frog    86 F------SYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQTIPLGCPTVGDGETCLVSGWG 144

  Fly   148 QITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASV-PGVKDACEGDSGGPAVYQG 211
            ..|...:....:::.|:|..:.:..|...:. ...||:.|.||.| .|.||:|:||||||.|...
 Frog   145 TTTSPEETFPDELQCVEVQTVSQDYCQGAFP-TDEITDNMLCAGVMEGGKDSCQGDSGGPLVCNS 208

  Fly   212 QLCGIVSWG-VGCARKSSPGVYTNV 235
            .:.||.||| ..|...:.||:||.:
 Frog   209 MVHGITSWGNTPCGVANKPGIYTKI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 70/220 (32%)
Tryp_SPc 25..244 CDD:238113 69/219 (32%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 69/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.