DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and zgc:171509

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:217 Identity:79/217 - (36%)
Similarity:114/217 - (52%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRL---T 85
            :|:||......|.|:...|. .|..:|||||:....||:||||    .:|.|:|..|...|   .
Zfish    20 KIIGGHECQPHSQPWQARLD-DGYGLCGGSLIHESWVVSAAHC----KSSSIIVHLGKHDLFVVE 79

  Fly    86 ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPKVSTIELCNTSFKAGDLIKVSGWGQI 149
            :|......:||.:...||.|...:|:.::||:.| :....|..:.|......||:...||||| :
Zfish    80 DTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQCLVSGWG-V 143

  Fly   150 TERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVYQGQL 213
            |  ..::|..::.:::.::.:..|.|.|  ...||..||||. :.|.||:|:||||||.|..|.|
Zfish   144 T--GDSISSTLQCLELPILSKADCKSAY--GRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTL 204

  Fly   214 CGIVSWGVGCARKSSPGVYTNV 235
            .||||:|:|||....||||..|
Zfish   205 KGIVSFGIGCAEPGFPGVYVEV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/217 (36%)
Tryp_SPc 25..244 CDD:238113 79/216 (37%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 79/217 (36%)
Tryp_SPc 21..234 CDD:238113 79/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.