DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and zgc:165423

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:247 Identity:79/247 - (31%)
Similarity:121/247 - (48%) Gaps:18/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-KGIGASRI 75
            |.|..|  ..|::||||......|.|:..:|...|:..|||||::.|.:::||||. .....|..
Zfish    27 PACGKA--PLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPSDY 89

  Fly    76 LVVAGVTRLTE-----TGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIEL-CNT 133
            .|..|  |.::     ..|...|.:|.....|...|..:|:|:|.|.:|:: ...:..:.| .:.
Zfish    90 TVYLG--RQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAADG 152

  Fly   134 SFKAGDLIKVSGWGQITERNKAVSMQV-RSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVK 196
            |....|.:.::|||.|.......|.|: :.|:|.::....|...|....:|||.|.||. :.|.|
Zfish   153 STFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGK 217

  Fly   197 DACEGDSGGPAVYQG----QLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244
            |:|:||||||.|.:.    ...|:||:|.|||..:.||||..|...:::|.:
Zfish   218 DSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 74/231 (32%)
Tryp_SPc 25..244 CDD:238113 75/232 (32%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 74/231 (32%)
Tryp_SPc 38..269 CDD:238113 75/232 (32%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.