DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and AT1G49170

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_175343.2 Gene:AT1G49170 / 841340 AraportID:AT1G49170 Length:126 Species:Arabidopsis thaliana


Alignment Length:121 Identity:44/121 - (36%)
Similarity:71/121 - (58%) Gaps:12/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KNDAKAMPAKEASPISVDKSGNICIQIL----------AKPGAKQNGITGIGFEGVGVQIAAPPS 82
            |...|...|.|::.::...|...|:::|          ||||:|...||.:..|.|||||.||..
plant     5 KKGKKTKSAAESTTVTESSSFPTCLRLLTPSSVAITIHAKPGSKAASITDVSDEAVGVQIDAPAR 69

  Fly    83 EGEANAELVKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKES 138
            :|||||.|::::|.|||:::..|||..||:||:|::::..  .|.:::.|.|.:.|
plant    70 DGEANAALLEYMSSVLGVKRRQVSLGSGSKSRDKVVIVED--MTQQSVFQALSQAS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 34/77 (44%)
AT1G49170NP_175343.2 DUF167 36..108 CDD:396929 33/71 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3216
eggNOG 1 0.900 - - E1_KOG3276
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546648at2759
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto3632
orthoMCL 1 0.900 - - OOG6_102805
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.