DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and zgc:193812

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001278817.1 Gene:zgc:193812 / 797701 ZFINID:ZDB-GENE-081022-44 Length:163 Species:Danio rerio


Alignment Length:144 Identity:69/144 - (47%)
Similarity:88/144 - (61%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RRLFTS-------VNAQIMSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNICIQILAKPG 59
            |.|.||       |.:|..:..| |.|....|.|     :|.....|:...|.|.|.|.|.||||
Zfish    25 RTLLTSKPTLRNPVYSQYNTMPK-KDKTSKSSPK-----VPEIPPGPVMKLKDGTITIAIHAKPG 83

  Fly    60 AKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGV 124
            ||||.:|.:..|.|||.|||||::|||||||::||||||.|:||:|||||||:||.|:|.:|..|
Zfish    84 AKQNAVTDVSEEAVGVAIAAPPTDGEANAELLRFLSKVLQLKKSEVSLDKGSKSREKVIRVTADV 148

  Fly   125 STVEAIEQLLRKES 138
            |..|.:::|..:.|
Zfish   149 SQEEILKKLRTEAS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 47/67 (70%)
zgc:193812NP_001278817.1 DUF167 76..144 CDD:280714 47/67 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579036
Domainoid 1 1.000 97 1.000 Domainoid score I7228
eggNOG 1 0.900 - - E1_KOG3276
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4844
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546648at2759
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto39287
orthoMCL 1 0.900 - - OOG6_102805
Panther 1 1.100 - - LDO PTHR13420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.