DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and 3110040N11Rik

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001357699.1 Gene:3110040N11Rik / 67290 MGIID:1914540 Length:181 Species:Mus musculus


Alignment Length:111 Identity:57/111 - (51%)
Similarity:73/111 - (65%) Gaps:2/111 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GVESAKNDAKAMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEAN 87
            |....|....|.||  |.|::.|..|.:.|.|.||||::||.:|.:..|.|||.|||||||||||
Mouse    66 GKNQTKEPETAPPA--AGPVATDPKGFVTIAIHAKPGSRQNAVTDLSTEAVGVAIAAPPSEGEAN 128

  Fly    88 AELVKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQL 133
            |||.::|||||.||||||.||||.:||.|::.:....:..|.:|:|
Mouse   129 AELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEKL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 45/67 (67%)
3110040N11RikNP_001357699.1 DUF167 91..161 CDD:376843 45/69 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7561
eggNOG 1 0.900 - - E1_KOG3276
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12109
Inparanoid 1 1.050 114 1.000 Inparanoid score I4830
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto95165
orthoMCL 1 0.900 - - OOG6_102805
Panther 1 1.100 - - LDO PTHR13420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3648
SonicParanoid 1 1.000 - - X6150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.