DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and c15orf40

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_012814279.1 Gene:c15orf40 / 448285 XenbaseID:XB-GENE-946779 Length:142 Species:Xenopus tropicalis


Alignment Length:136 Identity:65/136 - (47%)
Similarity:89/136 - (65%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FTSVNAQIMS-KSKGKSKAGVESAKNDAK-AMPAKEASPISVDKSGNICIQILAKPGAKQNGITG 67
            |..|.|:.:: ..|||      ..|.||. .:|.  ..|:|.||:|::.|.|.||||||||.||.
 Frog    13 FICVTARTLAMPKKGK------GLKKDASPVVPV--TGPVSRDKTGSVIISIHAKPGAKQNAITD 69

  Fly    68 IGFEGVGVQIAAPPSEGEANAELVKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQ 132
            :..:.|||.|||||:||||||||.::|||||.|:||:||||||.:||.|::.|:..::....:|:
 Frog    70 VTADAVGVAIAAPPTEGEANAELCRYLSKVLVLKKSEVSLDKGGKSREKVVKISASITPEVVLEK 134

  Fly   133 LLRKES 138
            |  ||:
 Frog   135 L--KEA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 45/67 (67%)
c15orf40XP_012814279.1 DUF167 54..122 CDD:280714 45/67 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7453
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12109
Inparanoid 1 1.050 109 1.000 Inparanoid score I4752
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546648at2759
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto105349
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3648
SonicParanoid 1 1.000 - - X6150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.