DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and CG16865

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001260451.1 Gene:CG16865 / 34788 FlyBaseID:FBgn0028919 Length:247 Species:Drosophila melanogaster


Alignment Length:121 Identity:29/121 - (23%)
Similarity:47/121 - (38%) Gaps:26/121 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSVNAQIMSKSKGKS------KAGVESAKNDAKAMPAKEASPIS---VDKSGNICIQILAKPGAK 61
            |.|.:..:.::||:|      .:.::.:.....|.||..|.|..   ||.||.   :::.....|
  Fly   113 TFVMSNALIRNKGESPLTQLLNSEIKGSFKAPAAKPATSAGPDDSGIVDASGK---KVVVTRHTK 174

  Fly    62 QNGITGIGFEGVGVQ-IAAPPSEGEA---------NAELVKFLSKVLGLRKSDVSL 107
            ..|    .|..|.|. |.....|.||         ||.:::...:..|.:.|||.:
  Fly   175 NMG----KFSSVTVSTIDEEEDEIEAREIADSYANNARIIEKQLQRKGGKLSDVGI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 15/66 (23%)
CG16865NP_001260451.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.