DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and C15orf40

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_011519514.1 Gene:C15orf40 / 123207 HGNCID:28443 Length:194 Species:Homo sapiens


Alignment Length:97 Identity:51/97 - (52%)
Similarity:63/97 - (64%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQI 77
            |.|..|.:..|...:|...:.:|  ...|::||..|.:.|.|.||||:|||.:|.:..|.|.|.|
Human    28 MPKKAGATTKGKSQSKEPERPLP--PLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAI 90

  Fly    78 AAPPSEGEANAELVKFLSKVLGLRKSDVSLDK 109
            |||||||||||||.::|||||.||||||.|||
Human    91 AAPPSEGEANAELCRYLSKVLELRKSDVVLDK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 41/58 (71%)
C15orf40XP_011519514.1 DUF167 65..122 CDD:280714 39/56 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7723
eggNOG 1 0.900 - - E1_KOG3276
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12109
Inparanoid 1 1.050 111 1.000 Inparanoid score I4882
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546648at2759
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto91584
orthoMCL 1 0.900 - - OOG6_102805
Panther 1 1.100 - - LDO PTHR13420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3648
SonicParanoid 1 1.000 - - X6150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.