DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and LOC100363116

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_003750283.1 Gene:LOC100363116 / 100363116 RGDID:2324773 Length:126 Species:Rattus norvegicus


Alignment Length:122 Identity:62/122 - (50%)
Similarity:79/122 - (64%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KAGVES-AKNDAK--AMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQIAAPPS 82
            |||..| .||..|  ..|.....|::.|..|.:.|.|.||||:|||.:|.:..|.|||.||||||
  Rat     4 KAGATSKGKNQTKEPETPPPPTGPVATDSKGFVTIAIHAKPGSKQNAVTDLNTEAVGVAIAAPPS 68

  Fly    83 EGEANAELVKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESD 139
            ||||||||.::|||||.||||||.||||.:||.|::.:....:..|.:|: ||.|::
  Rat    69 EGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEK-LRTEAE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 46/67 (69%)
LOC100363116XP_003750283.1 DUF167 36..106 CDD:396929 46/69 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7341
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12109
Inparanoid 1 1.050 111 1.000 Inparanoid score I4788
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546648at2759
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto98653
orthoMCL 1 0.900 - - OOG6_102805
Panther 1 1.100 - - LDO PTHR13420
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6150
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.