DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG34426

DIOPT Version :9

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001097552.1 Gene:CG34426 / 5740622 FlyBaseID:FBgn0085455 Length:296 Species:Drosophila melanogaster


Alignment Length:142 Identity:48/142 - (33%)
Similarity:75/142 - (52%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGL-VCTDQPVICFQ 70
            |.||||..|  :.|.|..| .:..|||.::.:.||:...:..| ..:.|.:.. :||...:||..
  Fly     6 LSALVAPSI--VSAACGQC-VDAHSCIGESEFQLCYDGVRDQT-INYTCPESKPICTTYGIICMP 66

  Fly    71 RGEN-PASCGDTDSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTGSCPDGYFC---DASTQEIC 131
            .|.: ...|||..:||.|:.:.|||||||:|||.|.|.:...| :..|.:.:.|   :|::...|
  Fly    67 NGTSIERGCGDVSNCGVCSESTTFACTSRTTFAVCNGDVVSAN-SFDCAEDFVCSVKNAASGSPC 130

  Fly   132 VTKA-TDDSIIC 142
            :::. :.||.||
  Fly   131 ISRCDSSDSDIC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14958NP_647782.1 None
CG34426NP_001097552.1 DUF1450 <66..116 CDD:299744 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.