DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG34427

DIOPT Version :9

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001097553.2 Gene:CG34427 / 5740165 FlyBaseID:FBgn0085456 Length:269 Species:Drosophila melanogaster


Alignment Length:144 Identity:67/144 - (46%)
Similarity:88/144 - (61%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLIALV-AFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTDQPVICF 69
            ||:.:| ||.:|...:||||||||..:|||.|::.||||...|:.:|.:.|.:|..||:...||.
  Fly    11 GLVMVVLAFMVAQTVSDCNVCQSNQVACINSTSFYLCFGDGTPHRDQLYHCLEGFDCTNLTAICV 75

  Fly    70 QR-GENPASCGDTDSCGQCAP--NYTFACTSRSTFAFCFGAITPTNVTGSCPDGYFCDASTQEIC 131
            |: .:.|.|||||..||||:.  ||.|||.||..|..|:||..||...|.||.|..||||:..||
  Fly    76 QKSSQRPPSCGDTSQCGQCSANRNYLFACQSRGIFQMCYGATRPTGQFGYCPTGTVCDASSTAIC 140

  Fly   132 VTKATDDSIICHLN 145
            |.:....::.|.:|
  Fly   141 VPEVAGQTLTCDIN 154



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.