DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG13075

DIOPT Version :9

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648831.1 Gene:CG13075 / 39756 FlyBaseID:FBgn0036563 Length:339 Species:Drosophila melanogaster


Alignment Length:147 Identity:36/147 - (24%)
Similarity:65/147 - (44%) Gaps:23/147 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLLGLIALVAFPIAWIQA-DCNVC-QSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTD 63
            |.:::.|:|::|..::::.| .|..| :.|...|::|.:|..|..:..  ......|..|.||::
  Fly     1 MQRIIALVAIMACGLSFVAAQSCQTCLEQNDVYCVDQNSYQNCMKNGP--VGDIIECPSGTVCSN 63

  Fly    64 QPVICFQRGENPAS----CGDTD----SCGQCAPNYTFACTSRSTFAFC--FGAITPTNVTGSCP 118
            ...:|....|..::    ||.:.    .|..|:....:||.|.:.:|.|  .|.:..::|     
  Fly    64 SDSVCALISEVNSTILDVCGGSGGNGAQCEVCSSGAKYACVSSTQYARCSSAGDVLTSSV----- 123

  Fly   119 DGYFCDASTQEICVTKA 135
              |.|  .|.|||:..|
  Fly   124 --YNC--GTDEICIIDA 136



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.