DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG13308

DIOPT Version :9

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648261.2 Gene:CG13308 / 39011 FlyBaseID:FBgn0035932 Length:233 Species:Drosophila melanogaster


Alignment Length:153 Identity:51/153 - (33%)
Similarity:67/153 - (43%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLLGLIALVAF---PIAWIQADCNVCQS-NGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVC 61
            |.:.|.|:|:..|   .|..|:.|||||.| :..:||:.|::..|..|..| ....:.|..|..|
  Fly     1 MLRCLILLAIGVFLVIRILGIRGDCNVCASVSNVACISNTSFQFCSSSALP-AGPVYTCPTGYYC 64

  Fly    62 TDQPVICFQRGENPASCGDTD-------SCGQCAPNYTFACTSRSTFAFCFGAITPTNVTGSCPD 119
            |...|.|           :||       .||.|....||||.:..|||.|.|..||:.:.|||..
  Fly    65 TANDVTC-----------NTDVAQRSCIGCGTCDSGNTFACLTARTFALCLGTSTPSQIVGSCGS 118

  Fly   120 GYFCDASTQEICVTKATDDSIIC 142
            .|.||.:...||.:.|......|
  Fly   119 SYVCDFNNPYICGSPAAGSQATC 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.