Sequence 1: | NP_647782.1 | Gene: | CG14958 / 38387 | FlyBaseID: | FBgn0035413 | Length: | 145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729415.2 | Gene: | CG32023 / 317827 | FlyBaseID: | FBgn0052023 | Length: | 160 | Species: | Drosophila melanogaster |
Alignment Length: | 141 | Identity: | 47/141 - (33%) |
---|---|---|---|
Similarity: | 71/141 - (50%) | Gaps: | 17/141 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYKLLGLIALVAFPIAWIQAD--CNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTD 63
Fly 64 QPVICFQRGENPASC-GDTD-SCGQCAPNYTFACTSRSTFAFC-----FGAITPTNVTGSCPDGY 121
Fly 122 FCDASTQEICV 132 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471591 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2F9QR | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |