powered by:
Protein Alignment CG14957 and CG42494
DIOPT Version :9
Sequence 1: | NP_647781.1 |
Gene: | CG14957 / 38386 |
FlyBaseID: | FBgn0035412 |
Length: | 96 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163333.1 |
Gene: | CG42494 / 8674087 |
FlyBaseID: | FBgn0260026 |
Length: | 283 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 35/68 - (51%) |
Similarity: | 47/68 - (69%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 AGTWSADEACQNVDKSVIIANQNDSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKP 92
|..|||::.|..|.|:.:..||:|.||.:|:|||.:|.|..||||:|||.|:|||.||.|:.:||
Fly 215 AEPWSAEKTCLTVSKTTLFQNQDDPTCTTYLYCYFINGSATALIKNCKTNQYFDASLKSCSENKP 279
Fly 93 AGC 95
..|
Fly 280 DYC 282
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45443089 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014329 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.