DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14957 and CG42494

DIOPT Version :9

Sequence 1:NP_647781.1 Gene:CG14957 / 38386 FlyBaseID:FBgn0035412 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001163333.1 Gene:CG42494 / 8674087 FlyBaseID:FBgn0260026 Length:283 Species:Drosophila melanogaster


Alignment Length:68 Identity:35/68 - (51%)
Similarity:47/68 - (69%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AGTWSADEACQNVDKSVIIANQNDSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKP 92
            |..|||::.|..|.|:.:..||:|.||.:|:|||.:|.|..||||:|||.|:|||.||.|:.:||
  Fly   215 AEPWSAEKTCLTVSKTTLFQNQDDPTCTTYLYCYFINGSATALIKNCKTNQYFDASLKSCSENKP 279

  Fly    93 AGC 95
            ..|
  Fly   280 DYC 282



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.