DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and IGFN1

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_054195515.1 Gene:IGFN1 / 91156 HGNCID:24607 Length:3816 Species:Homo sapiens


Alignment Length:669 Identity:150/669 - (22%)
Similarity:234/669 - (34%) Gaps:177/669 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGS 77
            :||..:..:..:..::|.||    ..|:.:.:.....|.|||..|..:||..:..|.||.|:.|.
Human  3193 EGGSVQAELTLQVIDKPDPP----QGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 3253

  Fly    78 PHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASEL--------------SDPLTV 128
            ..|::....|.|......:.:|||.:|.||..|....|..:|.|.              |.|..:
Human  3254 STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 3318

  Fly   129 TLQRNAITV----PR------FIDELVDT--------NAVEDERI----------------EFRV 159
            :.....||:    ||      .:..|::.        .||.|:.:                ||||
Human  3319 SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 3383

  Fly   160 RIL-----GEPPPEINWFKDGYEIFSS---------RRTKIVNDNEASVLVIHQVALTDEGE--- 207
            ..:     |||.|..:      .:|:.         |..::.:.:..|:.:......|.||:   
Human  3384 TAVAPSGPGEPGPPSD------AVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 3442

  Fly   208 ---------------------------------------IKCTATNRAGHVITKA-RLMVQAP-- 230
                                                   ::.||.|..|.....| ..:|||.  
Human  3443 GYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 3507

  Fly   231 ---PKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSL-- 290
               ||..:..:.:|.|.|:..:.:|:.|.....|.|.:|||.:|   .|..:..|:.| |:.|  
Human  3508 TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG---LPLPKRSVTVT-KDGLTQ 3568

  Fly   291 LKIDNVLREDRGEYMVKAWNRLGED-STSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDG 354
            |.|......|.|.|.|......|:: :.||.:.|.|.|..||...|..:...:.|..|....|:.
Human  3569 LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEA 3633

  Fly   355 GCKIGNYIVEYFRVGWNVWLKAA----TTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESE 415
            .....:|.|.........|.:||    |.|   .||..::.|.||.|||.|:|..|.|:||..|:
Human  3634 QDVPLHYAVFTRSSAHGPWHEAADRIHTNR---FTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 3695

  Fly   416 LLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSA 480
            ...||..:...|......| ..|...||:...|      .|..|.|        .|.....|.:.
Human  3696 PWCIPRQRDRFTVKAPCYR-EPDLSQKPRFLVG------LRSHLLP--------QGCECCMSCAV 3745

  Fly   481 KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSAD--SANKPTTDSSNPK--------- 534
            :..|:|          .:::..:|.:|:    .:|::.|.|  .....|..|.:||         
Human  3746 QGSPRP----------HVTWFKNDRSLE----GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVA 3796

  Fly   535 ---LNLTLVTTTLAPLDKS 550
               |...:.|.||..::.|
Human  3797 ENTLGQAVSTATLIVIEPS 3815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020 31/111 (28%)
I-set 138..227 CDD:400151 25/175 (14%)
Ig strand B 155..159 CDD:409565 2/19 (11%)
Ig strand C 168..172 CDD:409565 0/3 (0%)
Ig strand E 194..197 CDD:409565 0/2 (0%)
Ig strand F 207..212 CDD:409565 0/46 (0%)
Ig strand G 220..223 CDD:409565 0/2 (0%)
Ig 243..323 CDD:472250 24/82 (29%)
Ig strand B 251..255 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 289..293 CDD:409353 2/5 (40%)
Ig strand F 303..308 CDD:409353 2/4 (50%)
Ig strand G 316..319 CDD:409353 0/2 (0%)
FN3 327..411 CDD:238020 26/87 (30%)
PHA03247 <420..718 CDD:223021 28/145 (19%)
IGFN1XP_054195515.1 Ig strand C 3144..3148 CDD:409406
Ig strand E 3171..3175 CDD:409406
Ig strand F 3185..3190 CDD:409406
Ig strand G 3198..3201 CDD:409406 0/2 (0%)
FN3 3209..3301 CDD:238020 29/95 (31%)
FN3 <3274..>3511 CDD:442628 42/242 (17%)
Ig 3523..3602 CDD:472250 24/82 (29%)
Ig strand B 3531..3535 CDD:409406 1/3 (33%)
Ig strand C 3544..3548 CDD:409406 1/3 (33%)
Ig strand E 3567..3571 CDD:409406 1/3 (33%)
Ig strand F 3581..3586 CDD:409406 2/4 (50%)
Ig strand G 3594..3598 CDD:409406 0/3 (0%)
FN3 3606..3695 CDD:238020 28/91 (31%)
Ig 3722..3811 CDD:472250 22/116 (19%)
Ig strand B 3739..3743 CDD:409543 0/3 (0%)
Ig strand C 3752..3756 CDD:409543 0/3 (0%)
Ig strand E 3777..3781 CDD:409543 0/3 (0%)
Ig strand F 3791..3796 CDD:409543 0/4 (0%)
Ig strand G 3804..3807 CDD:409543 0/2 (0%)
Ig 29..120 CDD:472250
Ig strand B 46..50 CDD:409543
Ig strand C 59..62 CDD:409543
Ig strand E 86..90 CDD:409543
Ig strand F 100..105 CDD:409543
Ig strand G 113..116 CDD:409543
THB 166..199 CDD:465725
Ig 309..395 CDD:472250
dermokine 966..>1318 CDD:455732
Ig 3022..3105 CDD:472250
Ig strand B 3038..3042 CDD:409559
Ig strand C 3050..3054 CDD:409559
Ig strand E 3075..3079 CDD:409559
Ig strand F 3089..3094 CDD:409559
Ig strand G 3098..3101 CDD:409559
Ig 3123..3205 CDD:472250 2/11 (18%)
Ig strand B 3131..3135 CDD:409406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.