DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and h2ac21

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001025496.1 Gene:h2ac21 / 594911 XenbaseID:XB-GENE-5719327 Length:130 Species:Xenopus tropicalis


Alignment Length:56 Identity:12/56 - (21%)
Similarity:25/56 - (44%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 LYERAMARFYEAVELEQASKSRKTSRDKLVTP----VPHQTPANLRKRLGSISEAE 852
            :|..|:..:..|..||.|..:.:.::...:.|    :..:....|.|.||.::.|:
 Frog    50 VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352
Ig 155..224 CDD:143165
IG_like 243..323 CDD:214653
Ig 250..323 CDD:299845
FN3 327..411 CDD:238020
h2ac21NP_001025496.1 PTZ00017 1..130 CDD:185399 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.