DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and mylkb

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_009300538.1 Gene:mylkb / 492576 ZFINID:ZDB-GENE-041111-150 Length:966 Species:Danio rerio


Alignment Length:359 Identity:93/359 - (25%)
Similarity:151/359 - (42%) Gaps:51/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVL 195
            :::|...|.|...|.|...|:.||:....::..:....|.|..||..:..|:...:.::.|...|
Zfish   159 EKDAGKPPVFKQPLSDITVVDGERLRLECQVTSDLQAAITWILDGKTVKPSKFIVLSHEGEKCSL 223

  Fly   196 VIHQVALTDEGEIKCTATNRAGH-----VIT-------------------------KARLMVQ-- 228
            .|.:....|||...|.|.|..|.     |:|                         :||:..:  
Zfish   224 TIDKALPEDEGRYTCRAENAHGKAECSCVVTVDDPSDPSADKKNRKSSSATPTTENEARIKKKPA 288

  Fly   229 -----APPK-IRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPG-GRFEVSNTE 286
                 :||: :..|...:    :.|.|.:.|.....|.||...|||...:.|.|| |...:..||
Zfish   289 PTKQGSPPQFLHFPGDQK----IRAGEKVELLGNFGGSPPITCTWLKFKKPIQPGNGGISIETTE 349

  Fly   287 KNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPP-GTPKLNMSFGKSATLSWTAP 350
            .:|.|.|....::..|.|.::..|:.|....|..:|:..:|:|| |.|..:.....|.||||..|
Zfish   350 NSSQLTIAASDQDHCGCYTLELQNKFGLKQASLNLTIVDKPDPPAGIPAASDIRRSSLTLSWYGP 414

  Fly   351 LDDGGCKIGNYIVEYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESE 415
            ..|||..:.:|.:|.:....|.|....:..:.|..:.:|:...:|||||:|.|.||:.|||.||.
Zfish   415 TYDGGSIVQSYNLEIWNSVDNTWNDLTSCNSTSFHVQNLLSDRQYKFRVRAVNVYGVGEPSAESG 479

  Fly   416 LLFIPDPKRGITKPKSATRIAG-----DEKDKPK 444
            .:.:...:  :|:.|....:..     ||:.:|:
Zfish   480 PIEVGAEE--VTEKKEEEEVGAAVSDDDEEKEPE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352 26/118 (22%)
Ig 155..224 CDD:143165 17/98 (17%)
IG_like 243..323 CDD:214653 23/80 (29%)
Ig 250..323 CDD:299845 21/73 (29%)
FN3 327..411 CDD:238020 30/84 (36%)
mylkbXP_009300538.1 I-set 166..255 CDD:254352 23/88 (26%)
IGc2 180..245 CDD:197706 16/64 (25%)
Ig 296..394 CDD:299845 28/101 (28%)
I-set 296..386 CDD:254352 25/93 (27%)
FN3 390..475 CDD:238020 30/84 (36%)
PKc_like 524..782 CDD:304357
Pkinase 527..782 CDD:278497
I-set 860..950 CDD:254352
IGc2 873..940 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.