DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and MYLK

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_024309300.1 Gene:MYLK / 4638 HGNCID:7590 Length:1924 Species:Homo sapiens


Alignment Length:380 Identity:108/380 - (28%)
Similarity:159/380 - (41%) Gaps:61/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTK-IVNDNEASV--LVI 197
            |.|.|..:|.|.:..|.:::..:.::..:||..|.|..:|..:   :.|| |:...|.|:  :.|
Human  1106 TAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTL---KTTKFIILSQEGSLCSVSI 1167

  Fly   198 HQVALTDEGEIKCTATNRAGHV---------------ITKARLMVQAPPKIRLP---RTYEDGLI 244
            .:....|.|..||.|.|.||..               .|||..|....||..||   .|..|..:
Human  1168 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATV 1232

  Fly   245 --------------------------VEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVS 283
                                      |.|.|.:.|...|.|..|...||:...:.|......:|.
Human  1233 KKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1297

  Fly   284 NTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPP-GTPKLNMSFGKSATLSW 347
            |:|..|.|.|....:|..|.|.:...|:||.......:||..:|:|| |||..:.....|.||||
Human  1298 NSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSW 1362

  Fly   348 TAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSG 412
            .....|||..:.:|.:|.:......|.:.||.|:.|..:.||:...||||||:|.|.||.||||.
Human  1363 YGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1427

  Fly   413 ESELLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQAD 467
            ||||..:.:...   :||....::.|::.:|       :|..|..|::..:..:|
Human  1428 ESELTTVGEKPE---EPKDEVEVSDDDEKEP-------EVDYRTVTINTEQKVSD 1472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352 27/106 (25%)
Ig 155..224 CDD:143165 21/86 (24%)
IG_like 243..323 CDD:214653 22/105 (21%)
Ig 250..323 CDD:299845 19/72 (26%)
FN3 327..411 CDD:238020 35/84 (42%)
MYLKXP_024309300.1 I-set 43..133 CDD:254352
I-set 171..260 CDD:254352
23ISL 261..422 CDD:318761
I-set 424..514 CDD:254352
I-set 524..610 CDD:254352
I-set 633..722 CDD:254352
I-set 731..819 CDD:254352
I-set 1108..1197 CDD:254352 24/91 (26%)
Ig8_hMLCK_like 1248..1345 CDD:143239 26/96 (27%)
FN3 1341..1433 CDD:238020 41/91 (45%)
STKc_MLCK1 1471..1729 CDD:271093 1/2 (50%)
I-set 1819..1909 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.