DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and MYBPH

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_004988.2 Gene:MYBPH / 4608 HGNCID:7552 Length:477 Species:Homo sapiens


Alignment Length:555 Identity:120/555 - (21%)
Similarity:187/555 - (33%) Gaps:155/555 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQGGRPKKNVHWKSAERPSPPGR-----PILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVE 71
            ||...|:.... .:|.:|:||..     |:|  :.|.:.....|.:.|:.|...|...:.||.:|
Human    47 PQAPAPQAPTA-STATKPAPPSEDVPSAPLL--LTLDDVSSSSVTVSWEPPERLGRLGLQGYVLE 108

  Fly    72 HRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNAIT 136
            ..|.|:..||..:..|:......:..|..|.::..|..|.:..|....:.|..|:.:.       
Human   109 LCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIR------- 166

  Fly   137 VPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVA 201
                            |.||                                             
Human   167 ----------------ENIE--------------------------------------------- 170

  Fly   202 LTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAIT 266
                                        .||||:||......|.:..|.:.|::...|:|.|..|
Human   171 ----------------------------APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQAT 207

  Fly   267 WLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPG 331
            |.|.|..: ...|..:...:::|:|.|.:..|.|.|.|.:.......|......:.|..:|.||.
Human   208 WTHNGHAL-DSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPS 271

  Fly   332 TPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALST-TLHDLIEGSEY 395
            :.:|...:|.:|.|.||.|.|.|..::..|:|:........|.........:| |:.|||.|:.|
Human   272 SIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSY 336

  Fly   396 KFRVKAENPYGLS-EPSGESELLFIPDPKRGI-TKPKSATRIAGDEKDKPKTGAGGMQVPPRRKT 458
            .|||.:||..||| ..:...||..|  .|..| .|||..  |..|..:.|               
Human   337 SFRVFSENLCGLSTSATVTKELAHI--QKADIAAKPKGF--IERDFSEAP--------------- 382

  Fly   459 LSPPRPQAD--ASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSAD 521
             |..:|.||  ::.|.|.:...|.:..|||::|..:.              ||:::.:|...:..
Human   383 -SFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKN--------------KMEIQGNPKYRALS 432

  Fly   522 SANKPTTDSSNPKLNLTLVTTTLAPLDKSVPSPKA 556
            .....|.:...|           :|.|..|.:.||
Human   433 EQGVCTLEIRKP-----------SPFDSGVYTCKA 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 25/102 (25%)
I-set 138..227 CDD:254352 3/88 (3%)
Ig 155..224 CDD:143165 2/68 (3%)
IG_like 243..323 CDD:214653 19/79 (24%)
Ig 250..323 CDD:299845 17/72 (24%)
FN3 327..411 CDD:238020 30/85 (35%)
MYBPHNP_004988.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 7/26 (27%)
UBQ <4..>69 CDD:333228 7/22 (32%)
FN3 71..157 CDD:238020 20/87 (23%)
Ig 191..263 CDD:325142 17/72 (24%)
FN3 267..355 CDD:238020 30/87 (34%)
I-set 382..471 CDD:254352 22/116 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.